HORDB

ID: hor000996
Uniprot ID: P06307
Protein name: Cholecystokinin-12
Gene name: CCK
Organism: Homo sapiens (Human)
Family: Gastrin/cholecystokinin family
Source: Human
Expression: NA
Disease: Diseases associated with CCK include Cholecystitis and Biliary Dyskinesia.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0051428 peptide hormone receptor binding
GO BP: GO:0001764 neuron migration; GO:0007165 signal transduction; GO:0007409 axonogenesis; GO:0007586 digestion; GO:0042755 eating behavior
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0030424 axon

Sequence: ISDRDYMGWMDF
Length: 12
Propeptide: MNSGVCLCVLMAVLAAGALTQPVPPADPAGSGLQRAEEAPRRQLRVSQRTDGESRAHLGALLARYIQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Signal peptide: MNSGVCLCVLMAVLAAGALT
Modification: T6 Sulfotyrosine;T12 Phenylalanine amide
Glycosylation: NA
Mutagenesis: 6-6Y->F: Reduces the quantity of secreted CCK8 by 50%.

Function: This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut.Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion.
Mechanism: NA
Cross BBB: NA
Target: CCKAR
Target Unid: P32238
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000996_AF2.pdb

hor000996_ESM.pdb

Mass:	173210	Formula:	C68H94N16O21S2
Absent amino acids:	ACEHKLNPQTV	Common amino acids:	D
pI:	3.83	Basic residues:	1
Polar residues:	3	Hydrophobic residues:	3
Hydrophobicity:	-60.83	Boman Index:	-2875
Half-Life:	20 hour	Half-Life Yeast:	30 min
Half-Life E.Coli:	>10 hour	Aliphatic Index	32.5
Instability Index:	6323.33	Extinction Coefficient cystines:	6990
Absorbance 280nm:	635.45